PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S09309.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family ZF-HD
Protein Properties Length: 95aa    MW: 10455.7 Da    PI: 8.4994
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S09309.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer108.53.8e-342683260
    ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                   ++vrY+eC+kNhAa++Gg+avDGC+Efm+s geegt++al CaACgCHRnFHRreve+e
  Jcr4S09309.20 26 RNVRYRECQKNHAANIGGYAVDGCREFMAS-GEEGTITALICAACGCHRNFHRREVETE 83
                   689**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-28192IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.9E-312780IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.5E-292980IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.4693079IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MRKRQVVLKG DGSSVSGGRV STTTMRNVRY RECQKNHAAN IGGYAVDGCR EFMASGEEGT  60
ITALICAACG CHRNFHRREV ETEEVSEYSP PNSSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012068197.12e-65PREDICTED: mini zinc finger protein 3-like
SwissprotQ9CA513e-39MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A067KG858e-51A0A067KG85_JATCU; Uncharacterized protein
STRINGGLYMA06G20810.11e-40(Glycine max)
STRINGGLYMA04G33640.11e-40(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.11e-39mini zinc finger 1